![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins) |
![]() | Protein Hypothetical protein Them2 [143179] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143181] (2 PDB entries) |
![]() | Domain d2f0xg1: 2f0x G:3-138 [132679] automatically matched to 2F0X A:3-138 complexed with so4 |
PDB Entry: 2f0x (more details), 2.3 Å
SCOP Domain Sequences for d2f0xg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0xg1 d.38.1.5 (G:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn katgkliaqgrhtkhl
Timeline for d2f0xg1: