SCOPe 2.01: Domain d2f0rb_: 2f0r B:

Lineage for d2f0rb_ (2f0r B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)

8. Domain d2f0rb_: 2f0r B: [132672]
   automated match to d1kppa_
   complexed with so4

Details for d2f0rb_

PDB Entry: 2f0r, 2.26 Å

PDB Description: crystallographic structure of human tsg101 uev domain

PDB Compounds: (B:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d2f0rb_:

Sequence; same for both SEQRES and ATOM records:

>d2f0rb_ d.20.1.2 (B:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp

Timeline for d2f0rb_:

• d2f0rb_ first appeared in SCOP 1.73, called d2f0rb1
  
• d2f0rb_ was called d2f0rb1 in SCOP 1.75
  
• d2f0rb_ appears in SCOPe 2.02
  
• d2f0rb_ appears in the current release, SCOPe 2.08