Lineage for d2f0rb1 (2f0r B:3-145)
- Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds) 
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2Superfamily d.20.1: UBC-like [54495] (4 families) 
Family d.20.1.2: UEV domain [75383] (2 proteins) 
Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75385] (6 PDB entries) 
Domain d2f0rb1: 2f0r B:3-145 [132672]
automatically matched to d1kppa_
complexed with so4
Details for d2f0rb1
PDB Entry: 2f0r (more details), 2.26 Å
PDB Description: crystallographic structure of human tsg101 uev domain
PDB Compounds: (B:) Tumor susceptibility gene 101 proteinSCOP Domain Sequences for d2f0rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0rb1 d.20.1.2 (B:3-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp
SCOP Domain Coordinates for d2f0rb1:
Click to download the PDB-style file with coordinates for d2f0rb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f0rb1:
- d2f0rb1 is new in SCOP 1.73
- d2f0rb1 appears in SCOP 1.75
- d2f0rb1 appears in the current release, SCOPe 2.08, called d2f0rb_
