SCOP 1.73: Domain d2f0rb1: 2f0r B:3-145

Lineage for d2f0rb1 (2f0r B:3-145)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.2: UEV domain [75383] (2 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (6 PDB entries)

8. Domain d2f0rb1: 2f0r B:3-145 [132672]
   automatically matched to d1kppa_
   complexed with so4

Details for d2f0rb1

PDB Entry: 2f0r, 2.26 Å

PDB Description: crystallographic structure of human tsg101 uev domain

PDB Compounds: (B:) Tumor susceptibility gene 101 protein

SCOP Domain Sequences for d2f0rb1:

Sequence; same for both SEQRES and ATOM records:

>d2f0rb1 d.20.1.2 (B:3-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp

Timeline for d2f0rb1:

• d2f0rb1 is new in SCOP 1.73
  
• d2f0rb1 appears in SCOP 1.75
  
• d2f0rb1 appears in the current release, SCOPe 2.08, called d2f0rb_