Lineage for d2f0rb1 (2f0r B:3-145)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720005Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 720006Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 720152Family d.20.1.2: UEV domain [75383] (2 proteins)
  6. 720153Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 720154Species Human (Homo sapiens) [TaxId:9606] [75385] (6 PDB entries)
  8. 720158Domain d2f0rb1: 2f0r B:3-145 [132672]
    automatically matched to d1kppa_
    complexed with so4

Details for d2f0rb1

PDB Entry: 2f0r (more details), 2.26 Å

PDB Description: crystallographic structure of human tsg101 uev domain
PDB Compounds: (B:) Tumor susceptibility gene 101 protein

SCOP Domain Sequences for d2f0rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0rb1 d.20.1.2 (B:3-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp

SCOP Domain Coordinates for d2f0rb1:

Click to download the PDB-style file with coordinates for d2f0rb1.
(The format of our PDB-style files is described here.)

Timeline for d2f0rb1: