SCOPe 2.04: Domain d2f0ra_: 2f0r A:

Lineage for d2f0ra_ (2f0r A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)

8. Domain d2f0ra_: 2f0r A: [132671]
   automated match to d1kppa_
   complexed with so4

Details for d2f0ra_

PDB Entry: 2f0r, 2.26 Å

PDB Description: crystallographic structure of human tsg101 uev domain

PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d2f0ra_:

Sequence; same for both SEQRES and ATOM records:

>d2f0ra_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp

Timeline for d2f0ra_:

• d2f0ra_ first appeared in SCOP 1.73, called d2f0ra1
  
• d2f0ra_ appears in SCOPe 2.03
  
• d2f0ra_ appears in SCOPe 2.05
  
• d2f0ra_ appears in the current release, SCOPe 2.08