![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.2: UEV domain [75383] (3 proteins) |
![]() | Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries) |
![]() | Domain d2f0ra_: 2f0r A: [132671] automated match to d1kppa_ complexed with so4 |
PDB Entry: 2f0r (more details), 2.26 Å
SCOPe Domain Sequences for d2f0ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0ra_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs dllgliqvmivvfgdeppvfsrp
Timeline for d2f0ra_: