Lineage for d2f0ra_ (2f0r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939400Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2939401Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2939402Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)
  8. 2939413Domain d2f0ra_: 2f0r A: [132671]
    automated match to d1kppa_
    complexed with so4

Details for d2f0ra_

PDB Entry: 2f0r (more details), 2.26 Å

PDB Description: crystallographic structure of human tsg101 uev domain
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d2f0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0ra_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d2f0ra_:

Click to download the PDB-style file with coordinates for d2f0ra_.
(The format of our PDB-style files is described here.)

Timeline for d2f0ra_: