![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) ![]() |
![]() | Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (2 proteins) |
![]() | Protein Baseplate protein (bpp), C-terminal domain [141123] (1 species) |
![]() | Species Lactococcus phage tp901-1 [TaxId:35345] [141124] (1 PDB entry) |
![]() | Domain d2f0cc1: 2f0c C:63-163 [132669] Other proteins in same PDB: d2f0ca2, d2f0cb2, d2f0cc2 automatically matched to 2F0C A:63-163 complexed with gol |
PDB Entry: 2f0c (more details), 1.65 Å
SCOP Domain Sequences for d2f0cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f0cc1 b.21.1.3 (C:63-163) Baseplate protein (bpp), C-terminal domain {Lactococcus phage tp901-1 [TaxId: 35345]} ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid
Timeline for d2f0cc1:
![]() Domains from other chains: (mouse over for more information) d2f0ca1, d2f0ca2, d2f0cb1, d2f0cb2 |