Lineage for d2f0cb1 (2f0c B:63-163)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306222Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1306223Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1306359Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 1306360Protein Baseplate protein (bpp), C-terminal domain [141123] (1 species)
  7. 1306361Species Lactococcus phage tp901-1 [TaxId:35345] [141124] (1 PDB entry)
    Uniprot Q9G096 63-163
  8. 1306363Domain d2f0cb1: 2f0c B:63-163 [132667]
    Other proteins in same PDB: d2f0ca2, d2f0cb2, d2f0cc2
    automated match to d2f0ca1
    complexed with gol

Details for d2f0cb1

PDB Entry: 2f0c (more details), 1.65 Å

PDB Description: Structure of the Receptor Binding Protein (ORF49, bbp) from lactophage tp901-1
PDB Compounds: (B:) Phage tp901-1 ORF49 (BPP)

SCOPe Domain Sequences for d2f0cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0cb1 b.21.1.3 (B:63-163) Baseplate protein (bpp), C-terminal domain {Lactococcus phage tp901-1 [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

SCOPe Domain Coordinates for d2f0cb1:

Click to download the PDB-style file with coordinates for d2f0cb1.
(The format of our PDB-style files is described here.)

Timeline for d2f0cb1: