SCOPe 2.08: Domain d2f0cb1: 2f0c B:63-163

Lineage for d2f0cb1 (2f0c B:63-163)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
   automatically mapped to Pfam PF08932

6. Protein Baseplate protein (bpp), C-terminal domain [141123] (1 species)

7. Species Lactococcus phage tp901-1 [TaxId:35345] [141124] (1 PDB entry)
   Uniprot Q9G096 63-163

8. Domain d2f0cb1: 2f0c B:63-163 [132667]
   Other proteins in same PDB: d2f0ca2, d2f0cb2, d2f0cc2
   automated match to d2f0ca1
   complexed with gol

Details for d2f0cb1

PDB Entry: 2f0c, 1.65 Å

PDB Description: Structure of the Receptor Binding Protein (ORF49, bbp) from lactophage tp901-1

PDB Compounds: (B:) Phage tp901-1 ORF49 (BPP)

SCOPe Domain Sequences for d2f0cb1:

Sequence; same for both SEQRES and ATOM records:

>d2f0cb1 b.21.1.3 (B:63-163) Baseplate protein (bpp), C-terminal domain {Lactococcus phage tp901-1 [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

Timeline for d2f0cb1:

• d2f0cb1 first appeared in SCOP 1.73
  
• d2f0cb1 appears in SCOPe 2.07