Lineage for d2f09a1 (2f09 A:1-82)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2397360Superfamily b.61.8: YdhA-like [141488] (1 family) (S)
    automatically mapped to Pfam PF09864
  5. 2397361Family b.61.8.1: YdhA-like [141489] (1 protein)
  6. 2397362Protein Hypothetical protein YdhA [141490] (1 species)
  7. 2397363Species Escherichia coli [TaxId:562] [141491] (1 PDB entry)
    Uniprot P28224 28-109
  8. 2397364Domain d2f09a1: 2f09 A:1-82 [132660]

Details for d2f09a1

PDB Entry: 2f09 (more details)

PDB Description: Solution Structure of the gene product of E. coli gene ydhA
PDB Compounds: (A:) Hypothetical protein ydhA

SCOPe Domain Sequences for d2f09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f09a1 b.61.8.1 (A:1-82) Hypothetical protein YdhA {Escherichia coli [TaxId: 562]}
mqtdtleyqcdekpltvklnnprqevsfvydnqllhlkqgisasgarytdgiyvfwskgd
eatvykrdrivlnncqlqnpqr

SCOPe Domain Coordinates for d2f09a1:

Click to download the PDB-style file with coordinates for d2f09a1.
(The format of our PDB-style files is described here.)

Timeline for d2f09a1: