![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.8: YdhA-like [141488] (1 family) ![]() automatically mapped to Pfam PF09864 |
![]() | Family b.61.8.1: YdhA-like [141489] (1 protein) |
![]() | Protein Hypothetical protein YdhA [141490] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141491] (1 PDB entry) Uniprot P28224 28-109 |
![]() | Domain d2f09a1: 2f09 A:1-82 [132660] |
PDB Entry: 2f09 (more details)
SCOPe Domain Sequences for d2f09a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f09a1 b.61.8.1 (A:1-82) Hypothetical protein YdhA {Escherichia coli [TaxId: 562]} mqtdtleyqcdekpltvklnnprqevsfvydnqllhlkqgisasgarytdgiyvfwskgd eatvykrdrivlnncqlqnpqr
Timeline for d2f09a1: