Lineage for d2f08c_ (2f08 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375526Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2375533Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 2375534Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
    Uniprot Q00855 18-146
  8. 2375539Domain d2f08c_: 2f08 C: [132658]
    automated match to d1ahk__
    complexed with p4c

Details for d2f08c_

PDB Entry: 2f08 (more details), 2.2 Å

PDB Description: Crystal structure of a major house dust mite allergen, Derf 2
PDB Compounds: (C:) mite allergen Der f II

SCOPe Domain Sequences for d2f08c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f08c_ b.1.18.7 (C:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOPe Domain Coordinates for d2f08c_:

Click to download the PDB-style file with coordinates for d2f08c_.
(The format of our PDB-style files is described here.)

Timeline for d2f08c_: