SCOPe 2.06: Domain d2f08c_: 2f08 C:

Lineage for d2f08c_ (2f08 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (3 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products
   automatically mapped to Pfam PF02221

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
   Uniprot Q00855 18-146

8. Domain d2f08c_: 2f08 C: [132658]
   automated match to d1ahk__
   complexed with p4c

Details for d2f08c_

PDB Entry: 2f08, 2.2 Å

PDB Description: Crystal structure of a major house dust mite allergen, Derf 2

PDB Compounds: (C:) mite allergen Der f II

SCOPe Domain Sequences for d2f08c_:

Sequence; same for both SEQRES and ATOM records:

>d2f08c_ b.1.18.7 (C:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

Timeline for d2f08c_:

• d2f08c_ first appeared in SCOP 1.73, called d2f08c1
  
• d2f08c_ appears in SCOPe 2.05
  
• d2f08c_ appears in SCOPe 2.07
  
• d2f08c_ appears in the current release, SCOPe 2.08