SCOP 1.73: Domain d2f08c1: 2f08 C:1-129

Lineage for d2f08c1 (2f08 C:1-129)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (2 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)

8. Domain d2f08c1: 2f08 C:1-129 [132658]
   automatically matched to d1ahk__
   complexed with p4c

Details for d2f08c1

PDB Entry: 2f08, 2.2 Å

PDB Description: Crystal structure of a major house dust mite allergen, Derf 2

PDB Compounds: (C:) mite allergen Der f II

SCOP Domain Sequences for d2f08c1:

Sequence; same for both SEQRES and ATOM records:

>d2f08c1 b.1.18.7 (C:1-129) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

Timeline for d2f08c1:

• d2f08c1 is new in SCOP 1.73
  
• d2f08c1 appears in SCOP 1.75
  
• d2f08c1 appears in the current release, SCOPe 2.08, called d2f08c_