Lineage for d2f05a_ (2f05 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715406Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 2715407Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 2715408Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 2715416Protein Sin3B [47764] (1 species)
  7. 2715417Species Mouse (Mus musculus) [TaxId:10090] [47765] (4 PDB entries)
  8. 2715419Domain d2f05a_: 2f05 A: [132651]
    automated match to d2f05a1

Details for d2f05a_

PDB Entry: 2f05 (more details)

PDB Description: solution structure of free pah2 domain of msin3b
PDB Compounds: (A:) paired amphipathic helix protein sin3b

SCOPe Domain Sequences for d2f05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f05a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus) [TaxId: 10090]}
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

SCOPe Domain Coordinates for d2f05a_:

Click to download the PDB-style file with coordinates for d2f05a_.
(The format of our PDB-style files is described here.)

Timeline for d2f05a_: