SCOPe 2.08: Domain d2f05a_: 2f05 A:

Lineage for d2f05a_ (2f05 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.59: PAH2 domain [47761] (1 superfamily)
   4 helices; open up-and-down bundle; binds alpha-helical peptides

4. Superfamily a.59.1: PAH2 domain [47762] (1 family)

5. Family a.59.1.1: PAH2 domain [47763] (3 proteins)

6. Protein Sin3B [47764] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47765] (4 PDB entries)

8. Domain d2f05a_: 2f05 A: [132651]
   automated match to d2f05a1

Details for d2f05a_

PDB Entry: 2f05

PDB Description: solution structure of free pah2 domain of msin3b

PDB Compounds: (A:) paired amphipathic helix protein sin3b

SCOPe Domain Sequences for d2f05a_:

Sequence; same for both SEQRES and ATOM records:

>d2f05a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus) [TaxId: 10090]}
esdsvefnnaisyvnkiktrfldhpeiyrsfleilhtyqkeqlhtkgrpfrgmseeevft
evanlfrgqedllsefgqflpeakr

Timeline for d2f05a_:

• d2f05a_ first appeared in SCOP 1.73, called d2f05a1
  
• d2f05a_ appears in SCOPe 2.07