SCOP 1.73: Domain d2f02b1: 2f02 B:1-313

Lineage for d2f02b1 (2f02 B:1-313)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (9 proteins)

6. Protein Tagatose-6-phosphate kinase LacC [142710] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [142711] (2 PDB entries)

8. Domain d2f02b1: 2f02 B:1-313 [132650]
   automatically matched to 2AWD A:1-313
   complexed with atp

Details for d2f02b1

PDB Entry: 2f02, 1.9 Å

PDB Description: crystal structure of lacc from enterococcus faecalis in complex with atp

PDB Compounds: (B:) tagatose-6-phosphate kinase

SCOP Domain Sequences for d2f02b1:

Sequence; same for both SEQRES and ATOM records:

>d2f02b1 c.72.1.1 (B:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]}
livtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlg
gfhgafianelkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflen
fdqlikqaeivtisgslakglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpy
likpnleelegllgqdfsenplaavqtaltkpmfagiewivislgkdgaiakhhdqfyrv
kiptiqaknpvgsgdatiaglayglakdapaaellkwgmaagmanaqermtghvdvenvk
khlmniqvveiak

Timeline for d2f02b1:

• d2f02b1 is new in SCOP 1.73
  
• d2f02b1 appears in SCOP 1.75
  
• d2f02b1 appears in the current release, SCOPe 2.08, called d2f02b2