Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (50 species) not a true protein |
Species Enterococcus faecalis [TaxId:226185] [187075] (3 PDB entries) |
Domain d2f02b2: 2f02 B:2-313 [132650] Other proteins in same PDB: d2f02a3, d2f02a4, d2f02b3 automated match to d1o14a_ complexed with atp |
PDB Entry: 2f02 (more details), 1.9 Å
SCOPe Domain Sequences for d2f02b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f02b2 c.72.1.0 (B:2-313) automated matches {Enterococcus faecalis [TaxId: 226185]} ivtvtmnpsidisylldhlkldtvnrtsqvtktpggkglnvtrvihdlggdviatgvlgg fhgafianelkkanipqaftsikeetrdsiailhegnqteileagptvspeeisnflenf dqlikqaeivtisgslakglpsdfyqelvqkahaqevkvlldtsgdslrqvlqgpwkpyl ikpnleelegllgqdfsenplaavqtaltkpmfagiewivislgkdgaiakhhdqfyrvk iptiqaknpvgsgdatiaglayglakdapaaellkwgmaagmanaqermtghvdvenvkk hlmniqvveiak
Timeline for d2f02b2: