Lineage for d2f01b1 (2f01 B:16-134)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674117Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 674118Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 674147Protein Streptavidin [50878] (1 species)
  7. 674148Species Streptomyces avidinii [TaxId:1895] [50879] (117 PDB entries)
  8. 674150Domain d2f01b1: 2f01 B:16-134 [132648]
    automatically matched to d1hy2a_
    complexed with btn, btq, gol

Details for d2f01b1

PDB Entry: 2f01 (more details), 0.85 Å

PDB Description: Epi-biotin complex with core streptavidin
PDB Compounds: (B:) streptavidin

SCOP Domain Sequences for d2f01b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f01b1 b.61.1.1 (B:16-134) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

SCOP Domain Coordinates for d2f01b1:

Click to download the PDB-style file with coordinates for d2f01b1.
(The format of our PDB-style files is described here.)

Timeline for d2f01b1: