Class b: All beta proteins [48724] (178 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein Streptavidin [50878] (1 species) |
Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries) |
Domain d2f01a_: 2f01 A: [132647] automated match to d1n9mc_ complexed with btn, btq, gol |
PDB Entry: 2f01 (more details), 0.85 Å
SCOPe Domain Sequences for d2f01a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f01a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv k
Timeline for d2f01a_: