Lineage for d2f01a_ (2f01 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2415301Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2415302Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2415334Protein Streptavidin [50878] (1 species)
  7. 2415335Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2415336Domain d2f01a_: 2f01 A: [132647]
    automated match to d1n9mc_
    complexed with btn, btq, gol

Details for d2f01a_

PDB Entry: 2f01 (more details), 0.85 Å

PDB Description: Epi-biotin complex with core streptavidin
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2f01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f01a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

SCOPe Domain Coordinates for d2f01a_:

Click to download the PDB-style file with coordinates for d2f01a_.
(The format of our PDB-style files is described here.)

Timeline for d2f01a_: