SCOPe 2.08: Domain d2f01a_: 2f01 A:

Lineage for d2f01a_ (2f01 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d2f01a_: 2f01 A: [132647]
   automated match to d1n9mc_
   complexed with btn, btq, gol

Details for d2f01a_

PDB Entry: 2f01, 0.85 Å

PDB Description: Epi-biotin complex with core streptavidin

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2f01a_:

Sequence; same for both SEQRES and ATOM records:

>d2f01a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Timeline for d2f01a_:

• d2f01a_ first appeared in SCOP 1.73, called d2f01a1
  
• d2f01a_ appears in SCOPe 2.07