Lineage for d2ezub3 (2ezu B:366-593)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694852Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 694951Protein Pyruvate oxidase [88754] (2 species)
  7. 694957Species Lactobacillus plantarum [TaxId:1590] [88755] (7 PDB entries)
  8. 694965Domain d2ezub3: 2ezu B:366-593 [132644]
    Other proteins in same PDB: d2ezua1, d2ezua2, d2ezub1, d2ezub2
    automatically matched to d1powa3
    complexed with fad, htl, mg, na, pyr; mutant

Details for d2ezub3

PDB Entry: 2ezu (more details), 2.16 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-acetyl-thiamin diphosphate
PDB Compounds: (B:) Pyruvate oxidase

SCOP Domain Sequences for d2ezub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezub3 c.36.1.9 (B:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

SCOP Domain Coordinates for d2ezub3:

Click to download the PDB-style file with coordinates for d2ezub3.
(The format of our PDB-style files is described here.)

Timeline for d2ezub3: