Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Lactobacillus plantarum [TaxId:1590] [254973] (6 PDB entries) |
Domain d2ezua3: 2ezu A:366-593 [132641] Other proteins in same PDB: d2ezua1, d2ezub1 automated match to d1powa3 complexed with fad, htl, mg, na, pyr |
PDB Entry: 2ezu (more details), 2.16 Å
SCOPe Domain Sequences for d2ezua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ezua3 c.36.1.0 (A:366-593) automated matches {Lactobacillus plantarum [TaxId: 1590]} kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqe dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd
Timeline for d2ezua3: