SCOPe 2.03: Domain d2ezua3: 2ezu A:366-593

Lineage for d2ezua3 (2ezu A:366-593)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Pyruvate oxidase [88754] (2 species)

7. Species Lactobacillus plantarum [TaxId:1590] [88755] (7 PDB entries)

8. Domain d2ezua3: 2ezu A:366-593 [132641]
   Other proteins in same PDB: d2ezua1, d2ezua2, d2ezub1, d2ezub2
   automatically matched to d1powa3
   complexed with fad, htl, mg, na, pyr

Details for d2ezua3

PDB Entry: 2ezu, 2.16 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-acetyl-thiamin diphosphate

PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d2ezua3:

Sequence; same for both SEQRES and ATOM records:

>d2ezua3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

Timeline for d2ezua3:

• d2ezua3 first appeared in SCOP 1.73
  
• d2ezua3 appears in SCOPe 2.02
  
• d2ezua3 appears in SCOPe 2.04
  
• d2ezua3 appears in the current release, SCOPe 2.08