Lineage for d2ez8b1 (2ez8 B:183-365)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828384Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 828385Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 828414Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 828535Protein Pyruvate oxidase [52476] (2 species)
    binds FAD
  7. 828541Species Lactobacillus plantarum [TaxId:1590] [52477] (7 PDB entries)
  8. 828545Domain d2ez8b1: 2ez8 B:183-365 [132624]
    Other proteins in same PDB: d2ez8a2, d2ez8a3, d2ez8b2, d2ez8b3
    automatically matched to d1powa1
    complexed with fad, mg, na, pyr, tdl; mutant

Details for d2ez8b1

PDB Entry: 2ez8 (more details), 1.96 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-lactyl-thiamin diphosphate
PDB Compounds: (B:) Pyruvate oxidase

SCOP Domain Sequences for d2ez8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez8b1 c.31.1.3 (B:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOP Domain Coordinates for d2ez8b1:

Click to download the PDB-style file with coordinates for d2ez8b1.
(The format of our PDB-style files is described here.)

Timeline for d2ez8b1: