Lineage for d2ez8a3 (2ez8 A:366-593)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 829076Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 829197Protein Pyruvate oxidase [88754] (2 species)
  7. 829203Species Lactobacillus plantarum [TaxId:1590] [88755] (7 PDB entries)
  8. 829206Domain d2ez8a3: 2ez8 A:366-593 [132623]
    Other proteins in same PDB: d2ez8a1, d2ez8a2, d2ez8b1, d2ez8b2
    automatically matched to d1powa3
    complexed with fad, mg, na, pyr, tdl; mutant

Details for d2ez8a3

PDB Entry: 2ez8 (more details), 1.96 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-lactyl-thiamin diphosphate
PDB Compounds: (A:) Pyruvate oxidase

SCOP Domain Sequences for d2ez8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez8a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

SCOP Domain Coordinates for d2ez8a3:

Click to download the PDB-style file with coordinates for d2ez8a3.
(The format of our PDB-style files is described here.)

Timeline for d2ez8a3: