| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
| Protein Pyruvate oxidase [88729] (2 species) |
| Species Lactobacillus plantarum [TaxId:1590] [88730] (7 PDB entries) |
| Domain d2ez8a2: 2ez8 A:9-182 [132622] Other proteins in same PDB: d2ez8a1, d2ez8a3, d2ez8b1, d2ez8b3 automatically matched to d1powa2 complexed with fad, mg, na, pyr, tdl; mutant |
PDB Entry: 2ez8 (more details), 1.96 Å
SCOP Domain Sequences for d2ez8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ez8a2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw
Timeline for d2ez8a2: