| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Pyruvate oxidase [52476] (2 species) binds FAD |
| Species Lactobacillus plantarum [TaxId:1590] [52477] (8 PDB entries) |
| Domain d2ez8a1: 2ez8 A:183-365 [132621] Other proteins in same PDB: d2ez8a2, d2ez8a3, d2ez8b2, d2ez8b3 automated match to d2ez9a1 complexed with fad, mg, na, pyr, tdl |
PDB Entry: 2ez8 (more details), 1.96 Å
SCOPe Domain Sequences for d2ez8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ez8a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led
Timeline for d2ez8a1: