Lineage for d2ez6a2 (2ez6 A:151-220)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904269Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1904270Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 1904271Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1904298Protein RNase III, C-terminal domain [54776] (3 species)
  7. 1904299Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)
  8. 1904302Domain d2ez6a2: 2ez6 A:151-220 [132617]
    Other proteins in same PDB: d2ez6a1, d2ez6b1
    automated match to d2nugb2
    protein/RNA complex; complexed with mg

Details for d2ez6a2

PDB Entry: 2ez6 (more details), 2.05 Å

PDB Description: crystal structure of aquifex aeolicus rnase iii (d44n) complexed with product of double-stranded rna processing
PDB Compounds: (A:) Ribonuclease III

SCOPe Domain Sequences for d2ez6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez6a2 d.50.1.1 (A:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOPe Domain Coordinates for d2ez6a2:

Click to download the PDB-style file with coordinates for d2ez6a2.
(The format of our PDB-style files is described here.)

Timeline for d2ez6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ez6a1