Class a: All alpha proteins [46456] (285 folds) |
Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (2 families) |
Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
Protein RNase III endonuclease catalytic domain [69067] (2 species) |
Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
Domain d2ez6a1: 2ez6 A:3-150 [132616] Other proteins in same PDB: d2ez6a2, d2ez6b2 automated match to d1rc7a1 protein/RNA complex; complexed with mg |
PDB Entry: 2ez6 (more details), 2.05 Å
SCOPe Domain Sequences for d2ez6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ez6a1 a.149.1.1 (A:3-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} mleqlekklgytfkdksllekalthvsyskkehyetleflgnalvnffivdllvqyspnk regflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsgr danftrelfyklfkedilsaikegrvkk
Timeline for d2ez6a1: