Lineage for d2ez4b2 (2ez4 B:9-182)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (21 species)
    not a true protein
  7. Species Lactobacillus plantarum [TaxId:1590] [254973] (7 PDB entries)
  8. Domain d2ez4b2: 2ez4 B:9-182 [132614]
    Other proteins in same PDB: d2ez4a1, d2ez4b1
    automated match to d2ez9a2
    complexed with fad, mg, na, po4, tpp

Details for d2ez4b2

PDB Entry: 2ez4 (more details), 2.03 Å

PDB Description: pyruvate oxidase variant f479w
PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d2ez4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ez4b2 c.36.1.0 (B:9-182) automated matches {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

SCOPe Domain Coordinates for d2ez4b2 are not available.

Timeline for d2ez4b2:

Domains from same chain:
(mouse over for more information)
d2ez4b1, d2ez4b3
Domains from other chains:
(mouse over for more information)
d2ez4a1, d2ez4a2, d2ez4a3