SCOPe 2.08: Domain d2ez4b1: 2ez4 B:183-365

Lineage for d2ez4b1 (2ez4 B:183-365)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Pyruvate oxidase [52476] (2 species)
   binds FAD

7. Species Lactobacillus plantarum [TaxId:1590] [52477] (8 PDB entries)

8. Domain d2ez4b1: 2ez4 B:183-365 [132613]
   Other proteins in same PDB: d2ez4a2, d2ez4a3, d2ez4b2, d2ez4b3
   automated match to d2ez9a1
   complexed with fad, mg, na, po4, tpp

Details for d2ez4b1

PDB Entry: 2ez4, 2.03 Å

PDB Description: pyruvate oxidase variant f479w

PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d2ez4b1:

Sequence; same for both SEQRES and ATOM records:

>d2ez4b1 c.31.1.3 (B:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

Timeline for d2ez4b1:

• d2ez4b1 first appeared in SCOP 1.73
  
• d2ez4b1 appears in SCOPe 2.07