Lineage for d2eyya2 (2eyy A:12-120)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1424635Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1424757Protein Crk proto-oncogen [82741] (1 species)
  7. 1424758Species Human (Homo sapiens) [TaxId:9606] [82742] (3 PDB entries)
  8. 1424761Domain d2eyya2: 2eyy A:12-120 [132605]
    Other proteins in same PDB: d2eyya1
    automatically matched to d1ju5a_

Details for d2eyya2

PDB Entry: 2eyy (more details)

PDB Description: ct10-regulated kinase isoform i
PDB Compounds: (A:) v-crk sarcoma virus CT10 oncogene homolog isoform a

SCOPe Domain Sequences for d2eyya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyya2 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]}
swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv
ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr

SCOPe Domain Coordinates for d2eyya2:

Click to download the PDB-style file with coordinates for d2eyya2.
(The format of our PDB-style files is described here.)

Timeline for d2eyya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eyya1