Lineage for d2eyva1 (2eyv A:12-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729809Protein Crk proto-oncogen [82741] (1 species)
  7. 729810Species Human (Homo sapiens) [TaxId:9606] [82742] (3 PDB entries)
  8. 729812Domain d2eyva1: 2eyv A:12-120 [132602]
    automatically matched to d1ju5a_

Details for d2eyva1

PDB Entry: 2eyv (more details)

PDB Description: sh2 domain of ct10-regulated kinase
PDB Compounds: (A:) v-crk sarcoma virus CT10 oncogene homolog isoform a

SCOP Domain Sequences for d2eyva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]}
swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv
ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr

SCOP Domain Coordinates for d2eyva1:

Click to download the PDB-style file with coordinates for d2eyva1.
(The format of our PDB-style files is described here.)

Timeline for d2eyva1: