SCOPe 2.08: Domain d2eyva2: 2eyv A:6-124

Lineage for d2eyva2 (2eyv A:6-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)

8. Domain d2eyva2: 2eyv A:6-124 [132602]
   Other proteins in same PDB: d2eyva3, d2eyva4
   automated match to d2eyva1

Details for d2eyva2

PDB Entry: 2eyv

PDB Description: sh2 domain of ct10-regulated kinase

PDB Compounds: (A:) v-crk sarcoma virus CT10 oncogene homolog isoform a

SCOPe Domain Sequences for d2eyva2:

Sequence; same for both SEQRES and ATOM records:

>d2eyva2 d.93.1.1 (A:6-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dseersswywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinss
gprppvppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsrsrqg

Timeline for d2eyva2:

• d2eyva2 first appeared in SCOP 1.73, called d2eyva1
  
• d2eyva2 appears in SCOPe 2.07