Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein Transcription-repair coupling factor TRCF, domain 1 [418974] (1 species) entire protein is similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus |
Species Escherichia coli [TaxId:562] [419438] (2 PDB entries) Uniprot P30958 |
Domain d2eyqb4: 2eyq B:5-348 [132599] Other proteins in same PDB: d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa5, d2eyqa6, d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb5, d2eyqb6 automatically matched to 2EYQ A:2-348 complexed with epe, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2eyq (more details), 3.2 Å
SCOPe Domain Sequences for d2eyqb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyqb4 c.37.1.19 (B:5-348) Transcription-repair coupling factor TRCF, domain 1 {Escherichia coli [TaxId: 562]} yrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeisqftd qmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcphsflh ghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpyrldf fddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrdpehi yqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtlarfe nrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptka
Timeline for d2eyqb4: