SCOPe 2.08: Domain d2eyqb4: 2eyq B:5-348

Lineage for d2eyqb4 (2eyq B:5-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Transcription-repair coupling factor TRCF, domain 1 [418974] (1 species)
   entire protein is similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus

7. Species Escherichia coli [TaxId:562] [419438] (2 PDB entries)
   Uniprot P30958

8. Domain d2eyqb4: 2eyq B:5-348 [132599]
   Other proteins in same PDB: d2eyqa1, d2eyqa2, d2eyqa3, d2eyqa5, d2eyqa6, d2eyqb1, d2eyqb2, d2eyqb3, d2eyqb5, d2eyqb6
   automatically matched to 2EYQ A:2-348
   complexed with epe, so4
   has additional subdomain(s) that are not in the common domain

Details for d2eyqb4

PDB Entry: 2eyq, 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor

PDB Compounds: (B:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2eyqb4:

Sequence; same for both SEQRES and ATOM records:

>d2eyqb4 c.37.1.19 (B:5-348) Transcription-repair coupling factor TRCF, domain 1 {Escherichia coli [TaxId: 562]}
yrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeisqftd
qmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcphsflh
ghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpyrldf
fddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrdpehi
yqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtlarfe
nrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptka

Timeline for d2eyqb4:

• d2eyqb4 first appeared in SCOP 1.73
  
• d2eyqb4 appears in SCOPe 2.07