![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Domain d2eyqb2: 2eyq B:349-465 [132597] Other proteins in same PDB: d2eyqa1, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6, d2eyqb1, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6 automatically matched to 2EYQ A:349-465 complexed with epe, so4 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2eyq (more details), 3.2 Å
SCOPe Domain Sequences for d2eyqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyqb2 c.37.1.19 (B:349-465) Transcription-repair coupling factor TRCF, domain 2 {Escherichia coli [TaxId: 562]} ananlgfqklpdlavqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikia pqrimrldeasdrgrylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrti
Timeline for d2eyqb2: