Lineage for d2eyqb1 (2eyq B:466-545)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055820Superfamily b.34.18: CarD-like [141259] (1 family) (S)
  5. 2055821Family b.34.18.1: CarD-like [141260] (1 protein)
    Pfam PF02559
  6. 2055822Protein Transcription-repair coupling factor, RRCF, middle domain [141261] (1 species)
  7. 2055823Species Escherichia coli [TaxId:562] [141262] (1 PDB entry)
    Uniprot P30958 466-545
  8. 2055825Domain d2eyqb1: 2eyq B:466-545 [132596]
    Other proteins in same PDB: d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6
    automatically matched to 2EYQ A:466-545
    complexed with epe, so4

Details for d2eyqb1

PDB Entry: 2eyq (more details), 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor
PDB Compounds: (B:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2eyqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyqb1 b.34.18.1 (B:466-545) Transcription-repair coupling factor, RRCF, middle domain {Escherichia coli [TaxId: 562]}
npdtlirnlaelhigqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvss
lhlisryaggaeenaplhkl

SCOPe Domain Coordinates for d2eyqb1:

Click to download the PDB-style file with coordinates for d2eyqb1.
(The format of our PDB-style files is described here.)

Timeline for d2eyqb1: