![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.18: CarD-like [141259] (1 family) ![]() |
![]() | Family b.34.18.1: CarD-like [141260] (1 protein) Pfam PF02559 |
![]() | Protein Transcription-repair coupling factor, RRCF, middle domain [141261] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [141262] (1 PDB entry) Uniprot P30958 466-545 |
![]() | Domain d2eyqb1: 2eyq B:466-545 [132596] Other proteins in same PDB: d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6 automatically matched to 2EYQ A:466-545 complexed with epe, so4 |
PDB Entry: 2eyq (more details), 3.2 Å
SCOPe Domain Sequences for d2eyqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyqb1 b.34.18.1 (B:466-545) Transcription-repair coupling factor, RRCF, middle domain {Escherichia coli [TaxId: 562]} npdtlirnlaelhigqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvss lhlisryaggaeenaplhkl
Timeline for d2eyqb1: