Lineage for d2eyqa4 (2eyq A:2-348)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478770Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2478959Protein Transcription-repair coupling factor, TRCF [142320] (1 species)
    similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus
  7. 2478960Species Escherichia coli [TaxId:562] [142321] (2 PDB entries)
    Uniprot P30958 2-348! Uniprot P30958 26-333! Uniprot P30958 349-465! Uniprot P30958 546-778! Uniprot P30958 779-989
  8. 2478965Domain d2eyqa4: 2eyq A:2-348 [132593]
    Other proteins in same PDB: d2eyqa1, d2eyqa6, d2eyqb1, d2eyqb6
    complexed with epe, so4

Details for d2eyqa4

PDB Entry: 2eyq (more details), 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor
PDB Compounds: (A:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2eyqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyqa4 c.37.1.19 (A:2-348) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}
peqyrytlpvkageqrllgeltgaacatlvaeiaerhagpvvliapdmqnalrlhdeisq
ftdqmvmnladwetlpydsfsphqdiissrlstlyqlptmqrgvlivpvntlmqrvcphs
flhghalvmkkgqrlsrdalrtqldsagyrhvdqvmehgeyatrgalldlfpmgselpyr
ldffddeidslrvfdvdsqrtleeveainllpahefptdkaaielfrsqwrdtfevkrdp
ehiyqqvskgtlpagieywqplffseplpplfsyfpantllvntgdletsaerfqadtla
rfenrgvdpmrpllppqslwlrvdelfselknwprvqlktehlptka

SCOPe Domain Coordinates for d2eyqa4:

Click to download the PDB-style file with coordinates for d2eyqa4.
(The format of our PDB-style files is described here.)

Timeline for d2eyqa4: