![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein Transcription-repair coupling factor, TRCF [142320] (1 species) similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus |
![]() | Species Escherichia coli [TaxId:562] [142321] (2 PDB entries) Uniprot P30958 2-348! Uniprot P30958 26-333! Uniprot P30958 349-465! Uniprot P30958 546-778! Uniprot P30958 779-989 |
![]() | Domain d2eyqa2: 2eyq A:349-465 [132591] Other proteins in same PDB: d2eyqa1, d2eyqa6, d2eyqb1, d2eyqb6 complexed with epe, so4 |
PDB Entry: 2eyq (more details), 3.2 Å
SCOPe Domain Sequences for d2eyqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} ananlgfqklpdlavqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikia pqrimrldeasdrgrylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrti
Timeline for d2eyqa2: