Lineage for d2eyqa2 (2eyq A:349-465)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. Protein Transcription-repair coupling factor TRCF, domain 2 [418975] (1 species)
    entire protein is similar to UvrB in the N-terminal part and DEAD helicases in the C-terminal part; also contains CarD-like domain in the middle and TRCF domain at the C-terminus
  7. Species Escherichia coli [TaxId:562] [419439] (1 PDB entry)
    Uniprot P30958
  8. 2870889Domain d2eyqa2: 2eyq A:349-465 [132591]
    Other proteins in same PDB: d2eyqa1, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6, d2eyqb1, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6
    complexed with epe, so4
    missing some secondary structures that made up less than one-third of the common domain

Details for d2eyqa2

PDB Entry: 2eyq (more details), 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor
PDB Compounds: (A:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2eyqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor TRCF, domain 2 {Escherichia coli [TaxId: 562]}
ananlgfqklpdlavqaqqkapldalrkfletfdgpvvfsvesegrrealgellarikia
pqrimrldeasdrgrylmigaaehgfvdtvrnlalicesdllgervarrrqdsrrti

SCOPe Domain Coordinates for d2eyqa2:

Click to download the PDB-style file with coordinates for d2eyqa2.
(The format of our PDB-style files is described here.)

Timeline for d2eyqa2: