Lineage for d2ey4f_ (2ey4 F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2642076Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 2642077Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 2642099Protein automated matches [190486] (2 species)
    not a true protein
  7. 2642103Species Pyrococcus furiosus [TaxId:2261] [187680] (2 PDB entries)
  8. 2642105Domain d2ey4f_: 2ey4 F: [132585]
    Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4e1
    automated match to d2hvyc1
    complexed with zn

Details for d2ey4f_

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (F:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2ey4f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4f_ g.41.16.1 (F:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

SCOPe Domain Coordinates for d2ey4f_:

Click to download the PDB-style file with coordinates for d2ey4f_.
(The format of our PDB-style files is described here.)

Timeline for d2ey4f_: