Lineage for d2ey4f1 (2ey4 F:4-55)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893705Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
  5. 893706Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (2 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit ((75204))
  6. 893711Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 893715Species Archaeon Pyrococcus furiosus [TaxId:2261] [144215] (3 PDB entries)
    Uniprot Q8U1R4 4-55
  8. 893717Domain d2ey4f1: 2ey4 F:4-55 [132585]
    Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4c1, d2ey4d1
    automatically matched to 2EY4 E:4-55
    complexed with zn

Details for d2ey4f1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (F:) Ribosome biogenesis protein Nop10

SCOP Domain Sequences for d2ey4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4f1 g.41.16.1 (F:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

SCOP Domain Coordinates for d2ey4f1:

Click to download the PDB-style file with coordinates for d2ey4f1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4f1: