Class b: All beta proteins [48724] (178 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins) stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907 automatically mapped to Pfam PF04410 |
Protein automated matches [190631] (1 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [187679] (1 PDB entry) |
Domain d2ey4d_: 2ey4 D: [132583] Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4c1, d2ey4e1, d2ey4f_ automated match to d2hvyb1 complexed with zn |
PDB Entry: 2ey4 (more details), 2.11 Å
SCOPe Domain Sequences for d2ey4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ey4d_ b.43.3.5 (D:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs npeiyvgevlyvder
Timeline for d2ey4d_: