Lineage for d2ey4d_ (2ey4 D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062946Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins)
    stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
    automatically mapped to Pfam PF04410
  6. 2062953Protein automated matches [190631] (1 species)
    not a true protein
  7. 2062954Species Pyrococcus furiosus [TaxId:186497] [187679] (1 PDB entry)
  8. 2062955Domain d2ey4d_: 2ey4 D: [132583]
    Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4c1, d2ey4e1, d2ey4f_
    automated match to d2hvyb1
    complexed with zn

Details for d2ey4d_

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (D:) Small nucleolar rnp similar to gar1

SCOPe Domain Sequences for d2ey4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4d_ b.43.3.5 (D:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvder

SCOPe Domain Coordinates for d2ey4d_:

Click to download the PDB-style file with coordinates for d2ey4d_.
(The format of our PDB-style files is described here.)

Timeline for d2ey4d_: