Lineage for d2ey4d1 (2ey4 D:1-73)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801512Family b.43.3.5: Gar1-like SnoRNP [141341] (1 protein)
    stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
  6. 801513Protein Gar1 homolog PF1791 [141342] (1 species)
  7. 801514Species Archaeon Pyrococcus furiosus [TaxId:2261] [141343] (3 PDB entries)
    Uniprot Q8U029 1-73
  8. 801516Domain d2ey4d1: 2ey4 D:1-73 [132583]
    Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4e1, d2ey4f1
    automatically matched to 2EY4 C:1-73
    complexed with zn

Details for d2ey4d1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (D:) Small nucleolar rnp similar to gar1

SCOP Domain Sequences for d2ey4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4d1 b.43.3.5 (D:1-73) Gar1 homolog PF1791 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvd

SCOP Domain Coordinates for d2ey4d1:

Click to download the PDB-style file with coordinates for d2ey4d1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4d1: