![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
![]() | Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [141699] (2 PDB entries) Uniprot Q7LWY0 250-333 |
![]() | Domain d2ey4b1: 2ey4 B:253-336 [132580] Other proteins in same PDB: d2ey4a2, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4e1, d2ey4f_ automated match to d2ey4a1 complexed with zn |
PDB Entry: 2ey4 (more details), 2.11 Å
SCOPe Domain Sequences for d2ey4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ey4b1 b.122.1.1 (B:253-336) Pseudouridine synthase II TruB, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]} lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem lektkgiavdvekvfmprdwypkl
Timeline for d2ey4b1: