Lineage for d2ey4b1 (2ey4 B:253-336)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680326Family b.122.1.1: PUA domain [88698] (5 proteins)
    RNA-binding domain
  6. 680349Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)
  7. 680352Species Archaeon Pyrococcus furiosus [TaxId:2261] [141699] (2 PDB entries)
  8. 680354Domain d2ey4b1: 2ey4 B:253-336 [132580]
    Other proteins in same PDB: d2ey4a2, d2ey4b2, d2ey4c1, d2ey4d1, d2ey4e1, d2ey4f1
    automatically matched to 2EY4 A:253-336
    complexed with zn

Details for d2ey4b1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (B:) Probable tRNA pseudouridine synthase B

SCOP Domain Sequences for d2ey4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4b1 b.122.1.1 (B:253-336) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
lpkvwikdsavaavthgadlavpgiaklhagikrgdlvaimtlkdelvalgkammtsqem
lektkgiavdvekvfmprdwypkl

SCOP Domain Coordinates for d2ey4b1:

Click to download the PDB-style file with coordinates for d2ey4b1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4b1: