![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
![]() | Protein Pseudouridine synthase II TruB [69747] (5 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [143434] (2 PDB entries) Uniprot Q7LWY0 5-249 |
![]() | Domain d2ey4a2: 2ey4 A:8-252 [132579] Other proteins in same PDB: d2ey4a1, d2ey4b1, d2ey4c1, d2ey4d_, d2ey4e1, d2ey4f_ complexed with zn |
PDB Entry: 2ey4 (more details), 2.11 Å
SCOPe Domain Sequences for d2ey4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ey4a2 d.265.1.2 (A:8-252) Pseudouridine synthase II TruB {Pyrococcus furiosus [TaxId: 2261]} evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva wikkilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme kaveh
Timeline for d2ey4a2: