SCOP 1.73: Domain d2ey4a2: 2ey4 A:8-252

Lineage for d2ey4a2 (2ey4 A:8-252)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [143434] (2 PDB entries)

8. Domain d2ey4a2: 2ey4 A:8-252 [132579]
   Other proteins in same PDB: d2ey4a1, d2ey4b1, d2ey4c1, d2ey4d1, d2ey4e1, d2ey4f1
   complexed with zn

Details for d2ey4a2

PDB Entry: 2ey4, 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex

PDB Compounds: (A:) Probable tRNA pseudouridine synthase B

SCOP Domain Sequences for d2ey4a2:

Sequence; same for both SEQRES and ATOM records:

>d2ey4a2 d.265.1.2 (A:8-252) Pseudouridine synthase II TruB {Archaeon Pyrococcus furiosus [TaxId: 2261]}
evrrilpadikrevlikdenaetnpdwgfppekrpiemhiqfgvinldkppgptshevva
wikkilnlekaghggtldpkvsgvlpvalekatrvvqallpagkeyvalmhlhgdvpedk
iiqvmkefegeiiqrpplrsavkrrlrtrkvyyievleiegrdvlfrvgveagtyirsli
hhiglalgvgahmselrrtrsgpfkedetlitlhdlvdyyyfwkedgieeyfrkaiqpme
kaveh

Timeline for d2ey4a2:

• d2ey4a2 is new in SCOP 1.73
  
• d2ey4a2 appears in SCOP 1.75
  
• d2ey4a2 appears in the current release, SCOPe 2.08