SCOPe 2.08: Domain d2exyf1: 2exy F:1-106

Lineage for d2exyf1 (2exy F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2exyf1: 2exy F:1-106 [132576]
   Other proteins in same PDB: d2exya_, d2exyb_, d2exyc_, d2exyd2, d2exyf2
   automated match to d1ikfl1
   mutant

Details for d2exyf1

PDB Entry: 2exy, 3.1 Å

PDB Description: crystal structure of the e148q mutant of ecclc, fab complexed in absence of bound ions

PDB Compounds: (F:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d2exyf1:

Sequence; same for both SEQRES and ATOM records:

>d2exyf1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d2exyf1:

• d2exyf1 first appeared in SCOP 1.73
  
• d2exyf1 appears in SCOPe 2.07