Lineage for d2exyd2 (2exy D:107-211)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d2exyd2: 2exy D:107-211 [132575]
    Other proteins in same PDB: d2exya_, d2exyb_, d2exyc_, d2exyd1, d2exyf1
    automated match to d1ikfl2
    mutant

Details for d2exyd2

PDB Entry: 2exy (more details), 3.1 Å

PDB Description: Crystal structure of the E148Q Mutant of EcClC, Fab complexed in absence of bound ions
PDB Compounds: (D:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d2exyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exyd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d2exyd2 are not available.

Timeline for d2exyd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2exyd1
View in 3D
Domains from other chains:
(mouse over for more information)
d2exya_, d2exyb_, d2exyc_, d2exyf1, d2exyf2