Lineage for d2exyb_ (2exy B:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577647Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2577648Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2577649Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2577697Protein automated matches [226846] (3 species)
    not a true protein
  7. 2577731Species Escherichia coli [TaxId:562] [255156] (2 PDB entries)
  8. 2577735Domain d2exyb_: 2exy B: [132573]
    Other proteins in same PDB: d2exyd1, d2exyd2, d2exyf1, d2exyf2
    automated match to d1kpla_
    mutant

Details for d2exyb_

PDB Entry: 2exy (more details), 3.1 Å

PDB Description: Crystal structure of the E148Q Mutant of EcClC, Fab complexed in absence of bound ions
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2exyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exyb_ f.20.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d2exyb_:

Click to download the PDB-style file with coordinates for d2exyb_.
(The format of our PDB-style files is described here.)

Timeline for d2exyb_: